PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01501.20
Common NameJCGZ_00038, LOC105639374
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 186aa    MW: 21554.6 Da    PI: 8.9172
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01501.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.6e-27959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++ rqvtfskRr+g+lKK +ELSvLCda++ +iifsstgkl  y++
  Jcr4S01501.20  9 KRIENQTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCT 59
                   79***********************************************96 PP

2K-box28.65.8e-11721313693
          K-box  36 RhllGedLesLslke..LqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                     +++G ++ + + +e    +Leq+Le+s+ k+R++Knell +q+++l +k ++++ + ++
  Jcr4S01501.20  72 QKVKGTSIPEHDSREqlFDELEQELERSVAKVRNRKNELLQQQLDNLHRKIQDHRVAMEY 131
                    45567777666666654579******************************9998766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.207161IPR002100Transcription factor, MADS-box
SMARTSM004324.8E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.04E-41278No hitNo description
SuperFamilySSF554554.97E-31280IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-273859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-763124IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRGKIPIKR IENQTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFSS TGKLCQYCTE  60
PYRMQQIIER YQKVKGTSIP EHDSREQLFD ELEQELERSV AKVRNRKNEL LQQQLDNLHR  120
KIQDHRVAME YQHATLEAKP VEHQQVLDQF PFCGEPSSVL QLGTIHSQIH SYHLQLAQPN  180
LQGSSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-18171169Myocyte-specific enhancer factor 2B
1tqe_Q1e-18171169Myocyte-specific enhancer factor 2B
1tqe_R1e-18171169Myocyte-specific enhancer factor 2B
1tqe_S1e-18171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2166821e-47AC216682.1 Populus trichocarpa clone POP024-L07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079153.11e-125PREDICTED: protein TRANSPARENT TESTA 16-like
SwissprotQ8RYD91e-61TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLA0A067LFG71e-125A0A067LFG7_JATCU; Uncharacterized protein
STRINGPOPTR_0007s07620.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49352952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.28e-57MIKC_MADS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]